PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003497.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family bZIP
Protein Properties Length: 445aa    MW: 49463.5 Da    PI: 6.7851
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003497.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.55.8e-08111173163
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              eke +r rr   NRe+Ar   +R++a  eeL++k++ L  eN+ Lkke e   ke++ lks +
  Itr_sc003497.1_g00002.1 111 EKEARRLRRVLANRESARQTIRRRQAMYEELTKKAADLALENENLKKEKELAAKEYDCLKSTN 173
                              799********************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-8111175IPR004827Basic-leucine zipper domain
PfamPF001706.2E-8111173IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.829113176IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.5E-5115171No hitNo description
SuperFamilySSF579595.47E-6115171No hitNo description
CDDcd147029.30E-15116167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MAYRATTCRQ DDDGMVDCEL EAAEALAGLA HSALQSRSTA SDASESPANS RSPPPPHEDH  60
VTLLPRHNIE NPLPNILGSG NEFEISPSLT CSFDYPSVIG SKSRQNITEA EKEARRLRRV  120
LANRESARQT IRRRQAMYEE LTKKAADLAL ENENLKKEKE LAAKEYDCLK STNNCLKAQM  180
TSVVKEEPQD IHEVSNSTQP EMSTAPSFFY NRSPMMPCMW RPIFQPLDAI HLQHGSQNGF  240
SSNVGEPTPF LKQEHSTSNP TTPFYVLPFP WLLPFHAPNT YFPQSSDHNE TSVLHQCSVS  300
SSITPVSMEQ HRIFLPVKDE TEDSNSTQAI HKDDCKEVGL GFLSGLGTSC TTDGIRQHLE  360
PRPKQAAALM AGAKVSSLGG EVRDINTISS STVRQITRDS FEDKGVLTCP SKNSAEATAA  420
IEARKRRKEI MKLKNHLHCR PCHMH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1423428RKRRKE
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.14e-30bZIP family protein